Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 10 - Jul 15
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRSV Glycoprotein G (Strain A2), His tagProduct Specification Species HRSV Synonyms Major surface glycoprotein G, Attachment glycoprotein G, Membrane bound glycoprotein (mG) Accession P03423 Amino Acid Sequence Protein sequence(P03423, Ser64 Gln298, with C 10*His)
Product Specification
| Species | HRSV |
| Synonyms | Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein (mG) |
| Accession | P03423 |
| Amino Acid Sequence | Protein sequence(P03423, Ser64-Gln298, with C-10*His) SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:27.2kDa Actual:45-110kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Respiratory syncytial virus G protein is a protein produced by respiratory syncytial virus. The viral G protein is a highly glycosylated 90 kDa transmembrane protein, primarily responsible for the attachment of RSV to the host cell. Though not required for the production of infectious RSV or virus-like particles, RSV G is necessary for full infectivity and is found on the membrane of mature filaments. Additionally, RSV G interacts with both RSV M and F protein, which appears to be required for complete virion assembly.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 130 reviews
Sort
Product Reviews
★★★★★ 5
Sleek and Minimalist Bathroom Shelf
Color: A. Brown, Color: A. Brown
I recently got this bathroom shelf, and I love it! The minimalist design looks super clean and modern, and it fits perfectly in my bathroom without taking up too much space.
The build quality is great—it feels sturdy and well-made, and it holds my toiletries easily. Installation was simple, and it really helps keep things organized.
Overall, it’s a stylish, practical addition to any bathroom. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
★★★★★ 5
Perfect Rustic Touch for Our Bathroom Makeover!
Color: A. Brown, Color: A. Brown
We were redoing our bathroom and wanted a more rustic, farmhouse vibe and this shelf set absolutely delivered! As soon as I saw it, I fell in love with the design. The color (we chose Rustic Brown) is warm and charming, and it instantly made our bathroom feel cozier and more put-together.
Installation was super easy! The shelves are sturdy and well-made, with invisible brackets that give a clean, floating look. I especially love the metal basket; it holds several rolls of toilet paper and still looks decorative. The included sign is a cute bonus and adds a nice finishing touch.
The depth of the shelves is perfect for holding toiletries or small decorations without sticking out too far. It really maximized the space over our toilet and helped us stay organized without sacrificing style.
Overall, this set exceeded our expectations. It looks amazing, feels durable, and totally transformed our space. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2025
★★★★★ 5
Perfect for bathroom organization!
These QEEIG shelves are exactly what I needed to make use of the space over the toilet. They have a modern, clean design that goes with everything. They are sturdy and easy to install. My bathroom looks much more organized!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
★★★★★ 5
🌟🌟🌟🌟🌟
Color: A. Brown
Easy to put together. Looks great in bathroom. No missing parts. Quality and durable material
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
★★★★★ 4
This item will not disappoint!
Color: C. Black, Color: C. Black
With all honesty this item is such a game changer for my restroom. You get yours money worth because this item comes with good space for organizing your personal items. It is extremely strong and sturdy so go crazy with what you put on it :) The setting up part was a bit of a struggle for my husband but not because there was anything wrong with the item but mainly because it was so hard to have it align to my liking lol. It looks amazing now and I will say don’t be hesitant to purchase because you do get great quality with this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
recommand products
2018-2020 Fox 36 Performance Fork CSU Assembly - Black Ano Stanchions - 27.5" 180mm Max Travel - 29" 160mm Max Travel - 15x110 Boost - Matte Black Crown - 1.5" Tapered Steerer Tube - 37mm Offset
111.50
Lime & Grapefruit Fragrance Oil 10ml (Pack of 6)
10.00
Michelin Wild Enduro Front Tire - 27.5x2.8 - Gum-X3D - Gravity Shield
65.00
2024 Altoona Curve Bubba Chandler
14.75
ESI Chunky Grips - White
17.00